PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.9536s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 292aa    MW: 33427.9 Da    PI: 9.9372
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.9536s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.51.3e-3164114151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                          krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Cagra.9536s0004.1.p  64 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 114
                          79***********************************************95 PP

2K-box108.57.6e-361312283100
                K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                          +s++ s++e +a+++qqe+akL+++i ++q+++R+l+Ge ++s+s keL++Le +Le+s+++iRskKnell+++i+++qk+e +l+++n+
  Cagra.9536s0004.1.p 131 NSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKREVDLHNDNQ 220
                          45555699********************************************************************************** PP

                K-box  93 aLrkklee 100
                           Lr+k++e
  Cagra.9536s0004.1.p 221 ILRAKIAE 228
                          *****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-4056115IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.22156116IPR002100Transcription factor, MADS-box
CDDcd002651.07E-4457130No hitNo description
SuperFamilySSF554554.19E-3357129IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-335878IPR002100Transcription factor, MADS-box
PROSITE patternPS00350058112IPR002100Transcription factor, MADS-box
PfamPF003191.2E-2665112IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-337893IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-3393114IPR002100Transcription factor, MADS-box
PfamPF014863.5E-27141226IPR002487Transcription factor, K-box
PROSITE profilePS5129715.276142232IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MHNLTFHFLQ LLQISYFPEN HFPKKNKTFL FVLLPPTAIT AYQAELGEDS SPLRKSGRGK  60
IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL IVFSSRGRLY EYSNNSVKGT  120
IERYKKAISD NSNTGSVAEI NAQYYQQESA KLRQQIISIQ NSNRQLMGET IGSMSPKELR  180
NLEGRLERSI TRIRSKKNEL LFSEIDYMQK REVDLHNDNQ ILRAKIAENE RNNPSISLMP  240
GGSNYEQLMP PPQTQPQPFD SRNYFQVAAL QPNNHHYSSA GRQDQTALQL V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D1e-1957124168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-1957124168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-1957124168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-1957124168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S1e-1957124269Myocyte-specific enhancer factor 2B
1tqe_R1e-1957124269Myocyte-specific enhancer factor 2B
1tqe_Q1e-1957124269Myocyte-specific enhancer factor 2B
1tqe_P1e-1957124269Myocyte-specific enhancer factor 2B
3p57_J1e-1957124168Myocyte-specific enhancer factor 2A
3p57_I1e-1957124168Myocyte-specific enhancer factor 2A
3p57_D1e-1957124168Myocyte-specific enhancer factor 2A
3p57_C1e-1957124168Myocyte-specific enhancer factor 2A
3p57_B1e-1957124168Myocyte-specific enhancer factor 2A
3p57_A1e-1957124168Myocyte-specific enhancer factor 2A
3kov_J1e-1957124168Myocyte-specific enhancer factor 2A
3kov_I1e-1957124168Myocyte-specific enhancer factor 2A
3kov_B1e-1957124168Myocyte-specific enhancer factor 2A
3kov_A1e-1957124168Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5517720.0EU551772.1 Capsella bursa-pastoris AGAMOUS-like protein (AGa) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002870009.10.0hypothetical protein ARALYDRAFT_914774
SwissprotP178390.0AG_ARATH; Floral homeotic protein AGAMOUS
TrEMBLD7M9D00.0D7M9D0_ARALL; Putative uncharacterized protein
STRINGscaffold_702516.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61812237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-164MIKC_MADS family protein